PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g25050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family LFY
Protein Properties Length: 419aa    MW: 46535.2 Da    PI: 6.9842
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g25050genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY6121.1e-18613961386
    FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrld 100
                mdpe f++ lf+w+p  a+++p   + + +  +++p++ +++a  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+d+m+sls+ifr++
  Tp2g25050   1 MDPEGFTSGLFRWNPTRAMVQPLPPVPPLH--QQPPATPQTVAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSHIFRWE 98 
                9*************8777766555554333..33444567777888899*************************************************** PP

    FLO_LFY 101 llvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqe....glseepvqeekeaags.ggeglgeaelvaaeekkseeekkka 188
                llvGeryGikaavraerrrl+e  ee++++rr+l+      +  ++aldalsqe    glseepvq++ ++ ++ +++g g ++   + +    + kk +
  Tp2g25050  99 LLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLIlsaagDSGPHHALDALSQEddwtGLSEEPVQQQDQTDAAgNNGGDGGRGYWETGQ---AKMKKPQ 195
                ********************995445567888877777433333569******988889******9966644440333334444444332...2222222 PP

    FLO_LFY 189 skkkqkrkkkkelkseededeeeeededeeg......sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvt 282
                   +++rkk   ++ e+d+d +e ed+d+++      +g  g+erqrehPfivtepgevargkknGLDYLf+LyeqCr+fLlqvq+iak+rGekcPtkvt
  Tp2g25050 196 ---QRRRKKPMATSVETDDDGNEGEDDDGMDngngggGGGLGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLLQVQTIAKDRGEKCPTKVT 292
                ...2333333333344444444444444433122222555566********************************************************* PP

    FLO_LFY 283 nqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChler 382
                nqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler
  Tp2g25050 293 NQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLER 392
                **************************************************************************************************** PP

    FLO_LFY 383 skas 386
                ++a+
  Tp2g25050 393 NNAV 396
                9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.0E-1971395IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QPLPPVPPLH QQPPATPQTV AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEDMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLILSAAGDS GPHHALDALS QEDDWTGLSE EPVQQQDQTD AAGNNGGDGG  180
RGYWETGQAK MKKPQQRRRK KPMATSVETD DDGNEGEDDD GMDNGNGGGG GGLGMERQRE  240
HPFIVTEPGE VARGKKNGLD YLFHLYEQCR DFLLQVQTIA KDRGEKCPTK VTNQVFRYAK  300
KSGASYINKP KMRHYVHCYA LHCLDEEASN ALRRAFKERG ENVGSWRQAC YKPLVNIACR  360
HGWDIDAVFN AHPRLSIWYV PTKLRQLCHL ERNNAVAAAT ALVGGISCTG SSASGRFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1292334191187PROTEIN LEAFY
2vy2_A1e-1292334191187PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ183620.0Z18362.1 Brassica oleracea gene encoding BOFH.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457875.10.0PREDICTED: protein LEAFY isoform X1
RefseqXP_013675387.10.0PREDICTED: protein LEAFY
RefseqXP_013727957.10.0PREDICTED: protein LEAFY
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ6XPU70.0Q6XPU7_LEACR; LEAFY-like protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)